PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC4340_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 359aa    MW: 39975.6 Da    PI: 9.0779
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC4340_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1239.8e-39118177261
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                 ++k+l+cprC+s+ntkfCyynny++sqPryfC++C+ryWt+GG++rnvPvG+grrknk +
  RrC4340_p1 118 PDKILPCPRCESANTKFCYYNNYNVSQPRYFCRNCQRYWTAGGSMRNVPVGSGRRKNKGW 177
                 7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-27119175IPR003851Zinc finger, Dof-type
PfamPF027017.0E-32120175IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.546122176IPR003851Zinc finger, Dof-type
PROSITE patternPS013610124160IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MSMLKSRDRE IKLFGRTITS LSAVNHYDMS KEASPSSSST CSPVAGPNMV IANNHEQDNS  60
RFKGPCILSD LNEPPRAASE ISISSPRSSK TNGDQQSEIT TTTTTSTSEE KPTTLTKPDK  120
ILPCPRCESA NTKFCYYNNY NVSQPRYFCR NCQRYWTAGG SMRNVPVGSG RRKNKGWASS  180
NHYLQVTSSE DYENNNNSGT ILSFGSSESS VTDTGKHQEN KTHQGFLPPQ VMLPNITSPW  240
PYQWSPTGPN TSFYPIPFYW GCTVPIWPTS ETSPCLGKRS RDQTEGDTKD TILRTSEATK  300
NVVWPKLPTK PEKKGLSLFN GFETKGSNRR SLVPEPSINL QANPAAMCRS MNFRESMQQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893530.0AC189353.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB043L15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013588756.10.0PREDICTED: cyclic dof factor 5-like
SwissprotQ9SEZ31e-172CDF5_ARATH; Cyclic dof factor 5
TrEMBLA0A0D3CZB00.0A0A0D3CZB0_BRAOL; Uncharacterized protein
STRINGBra004396.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM130901729
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69570.11e-156Dof family protein